PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Traes_7DL_AD4395F8F.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family MYB
Protein Properties Length: 287aa    MW: 31916.2 Da    PI: 6.0327
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Traes_7DL_AD4395F8F.1genomeIWGSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding52.98.2e-171461148
                           TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
        Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                           rg W++eEde+l + ++++G g+W+++++  g+ R++k+c++rw +yl
  Traes_7DL_AD4395F8F.1 14 RGLWSPEEDEKLMNHIAMYGHGCWSSVPKLAGLERCGKSCRLRWINYL 61
                           788*******************************************97 PP

2Myb_DNA-binding50.83.9e-1667111147
                            TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
        Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                            rg +++eE++l+++++ + G++ W+ Ia+ ++ gRt++++k++w++y
  Traes_7DL_AD4395F8F.1  67 RGTFSQEEEDLIIHLHSMIGNK-WSQIAAQLP-GRTDNEVKNFWNSY 111
                            899*******************.*********.************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.607.2E-27564IPR009057Homeodomain-like
PROSITE profilePS5129418.786961IPR017930Myb domain
SuperFamilySSF466898.61E-3011108IPR009057Homeodomain-like
SMARTSM007178.6E-131363IPR001005SANT/Myb domain
PfamPF002492.1E-151461IPR001005SANT/Myb domain
CDDcd001672.00E-111761No hitNo description
PROSITE profilePS5129426.03362116IPR017930Myb domain
Gene3DG3DSA:1.10.10.604.0E-2665116IPR009057Homeodomain-like
SMARTSM007173.8E-1566114IPR001005SANT/Myb domain
PfamPF002492.9E-1567111IPR001005SANT/Myb domain
CDDcd001671.80E-1069112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 287 aa     Download sequence    Send to blast
MAKQSCCYKK RLRRGLWSPE EDEKLMNHIA MYGHGCWSSV PKLAGLERCG KSCRLRWINY  60
LRPDLKRGTF SQEEEDLIIH LHSMIGNKWS QIAAQLPGRT DNEVKNFWNS YIKKKLRERG  120
IDPATHKPLA EATTSPTACR PVFSDAELVP TMTAALAQDQ VVKMLDSLKM PLDWPVGGVA  180
GNGVPESYQV PILQEGHMLQ QHCGTFPSVS SSSTLTATDV GTTLPWLELG PTDTISGHVD  240
QYAGALGELR WSDYFDGALQ GQCVYDSGMV DDDAVQFDDV HGLSNWC
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C8e-281211625128MYB TRANSFORMING PROTEIN
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK3544390.0AK354439.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, complete cds, clone: NIASHv1007F18.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003557879.11e-144PREDICTED: myb-related protein 308-like
TrEMBLW5I2C70.0W5I2C7_WHEAT; Uncharacterized protein
STRINGMLOC_37780.30.0(Hordeum vulgare)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP30923385
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G09540.13e-78myb domain protein 61
Publications ? help Back to Top
  1. Brenchley R, et al.
    Analysis of the bread wheat genome using whole-genome shotgun sequencing.
    Nature, 2012. 491(7426): p. 705-10
    [PMID:23192148]